The following amino acid sequence was derived from the DNA sequence of a gene encoding a hypothetical type I integral plasma membrane protein. (The merely indicate every 10 amino acids beginning with M1 & ending with V140). Use this information as necessary to answer questions 1-2.
MGIIVLLLLWVIALILAVAVEKCPLLYINCTRLSPQRTNYSQRPLLFFWMVILIVLALIF LVIIVMPKKP KDSHYRILVTKHEDQNITEHKRPDGEECTSKRIANPTYCPRKDELQLHDVKRIANPLWCP RKDELQLHDVWhat localization and/or topogenic sequence(s) does this hypothetical protein contain?A. Internal signal anchor.B. N-terminal signal sequence + internal signal anchor.C. N-terminal signal sequence + stop transfer anchor.D. N-terminal signal sequence + stop transfer anchor + ER retrieval sequence.E. Internal signal anchor + ER retrieval sequence.Question 2 of 5Which amino acids could undergo Man8 glycosylation in the ER?A. N29 & N39B. N86 & N105C. S34 & S41D. S73 & S100E. None of the above. Man8 glycosylation occurs in the cis-golgi
Question 3 of 5Time for a chimeric protein.As you’ll recall, Hac1 protein (HAC1P) is involved in the unfolded protein response. Using recombinant DNA techniques, you generate a chimeric HAC1P to which you have aIDed the the first 21 amino acids encoded by the LDL receptor gene at its N-terminus, recognition sites for NAGPT, a binding site for AP2, and finally, changed the last 4 amino acids to leu-asn-gly-lys. Where is this chimeric HAC1P going to be directed as its final destination?A. Chimeric HAC1P will remain in the cytosol.B. Chimeric HAC1P will be targeted to the nucleus.C. Chimeric HAC1P will become a resident ER protein.D. Chimeric HAC1P will be targeted to the lysosome.E. Chimeric HAC1P will be targeted to the plasma membrane.Question 4 of 5Which of the following would you observe for a GFP fusion protein containing an N-terminal signal sequence & whose last 4 amino acids are Asn-Pro-Val-Tyr?A. It’s a type I integral plasma membrane protein with NANA glycosylation.B. It’s a protein that is targeted to the lysosome with Man8 glycosylation.C. It’s a resident ER protein with Man5 glycosylation.D. It’s endocytosed from the plasma membrane, dissociates in the late endosome and recycled back to the plasma membrane.E. It’s secreted with NANA glycosylation.Question 5 of 5Using recombinant DNA techniques, you generate a chimeric glutathione reductase (GR) that now has the first 21 amino acids encoded by the LDL receptor gene at its N-terminus and the last 4 amino acids also from the LDL receptor at its C-terminus. What are you likely to observe if you expressed this chimeric GR gene in an otherwise normal cell?A. Chimeric GR protein would undergo Mannose-6P modification in the cis-golgi and accumulate in the lysosome bound to intracellular cholesterol.B. Chimeric GR protein would be a type I integral membrane protein capable of endocytosing LDL particles.C. Chimeric GR protein would accumulate in the ER; increase the ratio of GSSG:GSH thereby promoting disulfide bond formation & enhancing protein folding.D. Chimeric GR protein would accumulate in the ER; increase the ratio of GSH:GSSG thereby inhibiting disulfide bond formation & enhancing protein misfolding.E. Chimeric GR protein would be secreted with no physiological effects.
Question 1 of 5You observe that a particular protein is modified by Glucosidase II and UDP-glucose-glycoprotein glucosyl transferase, but not Mannosidase I if otherwise normal mammalian cells are incubated at 40°C. However, this same protein is modified by Glucosidase II, Mannosidase I and N-Acetylglucosamine phosphotransferase if these cells are incubated at 32°C. Identify the protein.A. The protein is the allele of Mdr1 present in drug-resistant tumor cells.B. The protein is an allele of BiP in which KDEL has been replaced with REDV.C. The protein is the M6P receptor.D. The protein is the ?F508 allele of CFTR.E. The protein is an allele of a lysosomal enzyme with a missense mutation.
Question 2 of 5The lysosomes in cells from individuals with Tay-Sachs (T-S) disease are deficient in hexosaminidase A (HEXA). However, cells from some individuals with T-S exhibit normal lysosomes containing functional HEXA if they are incubated with a small molecule that resembles N-Acetylgalactosamine. Based on this observation, which of the following is the most likely cause of the HEXA deficiency in these particular T-S individuals?A. T-S cells lack the M6P receptor.B. T-S HEXA misfolds in the ER and is ERADicated.C. T-S HEXA lacks recognition sites for NAGPT.D. T-S cells lack NAGPT.E. T-S cells lack NAG glycosylation in the medial-golgi.
Question 3 of 5What causes the conversion of macrophage to foam cells?A. Macrophage within blood vessels, differentiate into foam cells in response to inflammation.B. Macrophage within the intima, accumulate excess HDL particles and become foam cells.C. Macrophage within the intima import LDL particles, accumulate lipid droplets & differentiate into foam cells.D. Undifferentiated monocytes within the intima import LDL particles, accumulate lipid droplets & differentiate into macrophage which are also called foam cells.E. Undifferentiated monocytes within the bloodstream import LDL particles, accumulate lipid droplets & differentiate into macrophage which are also called foam cells.
Question 4 of 5Why is the majority of cholesterol in the LDL particle esterified to linoleic acid?A. To increase the fluidity of the LDL particle so it’s less prone to clog an artery.B. To increase the amount of cholesterol packaged inside the LDL particle.C. To reduce the concentration of linoleic acid in the bloodstream.D. To reduce the amount of cholesterol packaged inside in the LDL particle.E. To reduce fluidity of the LDL particle so it’s more compact.
Question 5 of 5Which of the following describes the relationship between the level of a cell surface endocytic receptor (e.g., the LDL receptor) and the concentration of its corresponding ligand (e.g., the LDL particle)?A. Receptor level is proportional to intracellular ligand concentration.B. Receptor level is proportional to extracellular ligand concentration.C. Receptor level is inversely proportional to intracellular ligand concentration.D. Receptor level is inversely proportional to extracellular ligand concentration.E. There is no relationship between receptor level and its ligand concentration.
Why Choose Us
Top quality papers
We always make sure that writers follow all your instructions precisely. You can choose your academic level: high school, college/university or professional, and we will assign a writer who has a respective degree.
Professional academic writers
We have hired a team of professional writers experienced in academic and business writing. Most of them are native speakers and PhD holders able to take care of any assignment you need help with.
Free revisions
If you feel that we missed something, send the order for a free revision. You will have 10 days to send the order for revision after you receive the final paper. You can either do it on your own after signing in to your personal account or by contacting our support.
On-time delivery
All papers are always delivered on time. In case we need more time to master your paper, we may contact you regarding the deadline extension. In case you cannot provide us with more time, a 100% refund is guaranteed.
Original & confidential
We use several checkers to make sure that all papers you receive are plagiarism-free. Our editors carefully go through all in-text citations. We also promise full confidentiality in all our services.
24/7 Customer Support
Our support agents are available 24 hours a day 7 days a week and committed to providing you with the best customer experience. Get in touch whenever you need any assistance.
Try it now!
How it works?
Follow these simple steps to get your paper done
Place your order
Fill in the order form and provide all details of your assignment.
Proceed with the payment
Choose the payment system that suits you most.
Receive the final file
Once your paper is ready, we will email it to you.
Our Services
No need to work on your paper at night. Sleep tight, we will cover your back. We offer all kinds of writing services.
Essays
You are welcome to choose your academic level and the type of your paper. Our academic experts will gladly help you with essays, case studies, research papers and other assignments.
Admissions
Admission help & business writing
You can be positive that we will be here 24/7 to help you get accepted to the Master’s program at the TOP-universities or help you get a well-paid position.
Reviews
Editing your paper
Our academic writers and editors will help you submit a well-structured and organized paper just on time. We will ensure that your final paper is of the highest quality and absolutely free of mistakes.
Reviews
Revising your paper
Our academic writers and editors will help you with unlimited number of revisions in case you need any customization of your academic papers